PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587883.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 298aa    MW: 34126.4 Da    PI: 8.5349
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587883.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.6e-50331573128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkevlskk 96 
                     pGfrFhPtdeelv +yL++kve++++ l + ik++diyk++PwdLp++ +++e+ewy+++kr +ky+++ r+nr ++ sg+Wkatg dk+++s k
  XP_009587883.1  33 PGFRFHPTDEELVGFYLRRKVEKRPIGL-QLIKQMDIYKYDPWDLPQASNKGENEWYYYCKRGRKYKNSVRPNRvTAGSGFWKATGIDKSIYS-K 125
                     9*************************99.89***************98889999********************5556***************.9 PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ge++glkk+Lv+y+g+a kg+kt+W+mhe+rl
  XP_009587883.1 126 GEVIGLKKSLVYYRGSAGKGTKTEWMMHEFRL 157
                     99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.29331181IPR003441NAC domain
SuperFamilySSF1019414.32E-5431181IPR003441NAC domain
PfamPF023653.0E-2433157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEVEKISSNS IVTNNNYYNK LKAEEEDEDV PLPGFRFHPT DEELVGFYLR RKVEKRPIGL  60
QLIKQMDIYK YDPWDLPQAS NKGENEWYYY CKRGRKYKNS VRPNRVTAGS GFWKATGIDK  120
SIYSKGEVIG LKKSLVYYRG SAGKGTKTEW MMHEFRLPNL HSANTIAQEA EAWTLCRILK  180
RNASYRKFIP DWKVAAATPQ PKICSSNIDS SKSSQIYISF STPHVVKQNT CSDHVENKQL  240
LNVGQQSSGS ANDESMLSIS TVATASNSNS PLDFNEWLEH GNWDELKSIF ELSFDPFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-513318722174NAC domain-containing protein 19
3swp_C2e-513318722174NAC domain-containing protein 19
3swp_B2e-513318722174NAC domain-containing protein 19
3swp_A2e-513318722174NAC domain-containing protein 19
3swm_D2e-513318722174NAC domain-containing protein 19
3swm_C2e-513318722174NAC domain-containing protein 19
3swm_B2e-513318722174NAC domain-containing protein 19
3swm_A2e-513318722174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587883.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_016455213.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK552e-86NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM1BW991e-126M1BW99_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000544071e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-86NAC domain containing protein 42